General Information

  • ID:  hor000687
  • Uniprot ID:  Q99MP3
  • Protein name:  Calcitonin gene-related peptide 2
  • Gene name:  Calcb
  • Organism:  Mus musculus (Mouse)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  Detected in nerve cells of cerebrum, hippocampus and pons/midbrain in newborns, and only in nerve cells of pons/midbrain in adult.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTATCVTHRLADLLSRSGGVLKDNFVPTDVGSEAF
  • Length:  37
  • Propeptide:  MDFWKFFPFLALSTIWVLCLASSLQAAPFRSALESSLDLGTLGDQEKHLLLAALMQDYEQMKARKLEQEEQETKGSRVTAQKRSCNTATCVTHRLADLLSRSGGVLKDNFVPTDVGSEAFGRRRRRDLQA
  • Signal peptide:  MDFWKFFPFLALSTIWVLCLASSLQA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Ramp1, Calcrl
  • Target Unid:  Q9WTJ5, Q9R1W5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-Q99MP3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000687_AF2.pdbhor000687_ESM.pdb

Physical Information

Mass: 452465 Formula: C165H266N48O56S2
Absent amino acids: IMQWY Common amino acids: LSTV
pI: 5.57 Basic residues: 4
Polar residues: 15 Hydrophobic residues: 13
Hydrophobicity: 5.68 Boman Index: -5757
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.62
Instability Index: 3179.46 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  11761712
  • Title:  Structure of the Mouse Calcitonin/Calcitonin Gene-Related Peptide Alpha and Beta Genes